PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030217m
Common NameCICLE_v10030217mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 291aa    MW: 33543.8 Da    PI: 9.3777
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030217mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.42.5e-131771799
                     E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                     ++p  fa ++g++   +   tl+ ++gr+ +v l  +k ++ +++++GW eFv+ + +  g f+vFk++++s+f  +v++f++
  Ciclev10030217m  1 MIPPLFAIKFGHE--LTNAATLTLPNGRQSQVSL--KKDGRNVWFRDGWHEFVEIHSITPGYFLVFKYEKNSRF--RVHIFDT 77
                     6899999999866..6678999999*********..999999**************************999999..9*99997 PP

2B348.81.2e-152092881597
                      -EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3  15 rlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                        ++p kfa+e+ +  ++s+++++ +e+ rs  +    ++++g+++l+kGW e  k+++L egD++vF+l+++++  l++++f
  Ciclev10030217m 209 YAYVPAKFANEFFSRDAQSVKVQVLNETERSLHIH---WRHKGGFFLSKGWAELSKDKKLAEGDICVFQLIRKEDVLLKLSIF 288
                      4689********888899********999998765...599999***************************988876777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.63E-17180IPR015300DNA-binding pseudobarrel domain
CDDcd100173.94E-12176No hitNo description
SMARTSM010192.5E-4178IPR003340B3 DNA binding domain
PROSITE profilePS5086312.534178IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.2E-17280IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-11277IPR003340B3 DNA binding domain
SuperFamilySSF1019366.47E-16192279IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.0E-16193288IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.193195290IPR003340B3 DNA binding domain
CDDcd100178.21E-11196288No hitNo description
SMARTSM010191.9E-5198286IPR003340B3 DNA binding domain
PfamPF023623.0E-13209288IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MIPPLFAIKF GHELTNAATL TLPNGRQSQV SLKKDGRNVW FRDGWHEFVE IHSITPGYFL  60
VFKYEKNSRF RVHIFDTTAC EIKCPCMSEE SENVKDEMVD SEDCVEISKR LFAQKSLKWN  120
CKFGASLENS KVKYKCDPGS KKRKKEELAE KNESDELDLC DSLGEMGIYV SKRCRISAEG  180
KKRAIRIARL LKLKNPTFMV ILLPRDKHYA YVPAKFANEF FSRDAQSVKV QVLNETERSL  240
HIHWRHKGGF FLSKGWAELS KDKKLAEGDI CVFQLIRKED VLLKLSIFHA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_B6e-1517628927141B3 domain-containing transcription factor VRN
4i1k_A6e-1517628927141B3 domain-containing transcription factor VRN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140144KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423120.10.0hypothetical protein CICLE_v10030217mg
TrEMBLV4SC070.0V4SC07_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15912578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.17e-38B3 family protein